{"product_id":"proteintech-15587-1-ap","title":"Proteintech, 15587-1-AP, HIG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HIG2 (15587-1-AP) by Proteintech is a Polyclonal antibody targeting HIG2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n15587-1-AP targets HIG2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHIG2 (Hypoxia inducible gene 2), also known as hypoxia inducible lipid droplet associated (HILPDA),  is a gene that plays a significant role in the context of hypoxia, particularly in cancer biology.  HIG2 is can be induced by hypoxia and glucose deprivation. It is expressed under low-oxygen conditions, which are common in the tumor microenvironment, and has been identified as a target gene of hypoxia-inducible factor-1 (HIF-1). HIG2 is implicated in the development and progression of various types of cancer, including renal cell carcinoma(PMID: 15930302), cell lymphoma(PMID: 26757780), epithelial ovarian cancer(PMID: 20134266), and uterine cancer(PMID: 21614900). Its expression is often elevated in these cancers and is associated with poor prognosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7829 Product name: Recombinant human C7orf68 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC001863 Sequence: MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM Predict reactive species\nFull Name: chromosome 7 open reading frame 68\nCalculated Molecular Weight: 7 kDa\nObserved Molecular Weight: 7-10 kDa\nGenBank Accession Number: BC001863\nGene Symbol: C7orf68\nGene ID (NCBI): 29923\nRRID: AB_3669213\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5L2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887667597481,"sku":"15587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15587-1-ap","provider":"Iright","version":"1.0","type":"link"}