{"product_id":"proteintech-15591-1-ap","title":"Proteintech, 15591-1-AP, SELS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SELS (15591-1-AP) by Proteintech is a Polyclonal antibody targeting SELS in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15591-1-AP targets SELS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, HeLa cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSELS, also named as VIMP and SEPS1, plays an important role in the production of inflammatory cytokines and its expression is activated by endoplasmic reticulum (ER) stress. It probably acts by serving as a linker between DERL1 and VCP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7928 Product name: Recombinant human SELS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC005840 Sequence: MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG Predict reactive species\nFull Name: selenoprotein S\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC005840\nGene Symbol: SELS\nGene ID (NCBI): 55829\nRRID: AB_2263813\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQE4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868865056937,"sku":"15591-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15591-1-ap","provider":"Iright","version":"1.0","type":"link"}