{"product_id":"proteintech-15601-1-ap","title":"Proteintech, 15601-1-AP, PSMG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMG3 (15601-1-AP) by Proteintech is a Polyclonal antibody targeting PSMG3 in WB, IHC, ELISA applications with reactivity to human samples\n15601-1-AP targets PSMG3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  K-562 cells,  HeLa cells\nPositive IHC detected in: human stomach cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMG3, also named as C7orf48 and PAC3, is a chaperone protein which promotes assembly of the 20S proteasome. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7984 Product name: Recombinant human PSMG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC004308 Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW Predict reactive species\nFull Name: proteasome (prosome, macropain) assembly chaperone 3\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 13-18 kDa\nGenBank Accession Number: BC004308\nGene Symbol: PSMG3\nGene ID (NCBI): 84262\nRRID: AB_2878156\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BT73\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776420009,"sku":"15601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15601-1-ap","provider":"Iright","version":"1.0","type":"link"}