{"product_id":"proteintech-15613-1-ap","title":"Proteintech, 15613-1-AP, Fibronectin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Fibronectin (15613-1-AP) by Proteintech is a Polyclonal antibody targeting Fibronectin in WB, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n15613-1-AP targets Fibronectin in WB, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, NIH\/3T3 cells,  MDA-MB-453s cells\nPositive IP detected in: NIH\/3T3 cells\nPositive IF-P detected in: rat skin tissue, mouse brain tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells, HUVEC cells\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibronectins play a role in cell adhesion, motility, wound healing, and the maintenance of cell shape. Fibronectins bind to cell surfaces via interactions with integrins and various molecules such as collagen, fibrin, heparin, DNA, and actin (PMID: 3326130). Cellular interaction with fibronectin (FN1) promotes cell cycle progression and proliferation by influencing cyclins.What is the molecular weight of FN1?The molecular weight of FN1 is 220 kDa.What is the tissue specificity of FN1?FN1 is a large glycoprotein that exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1) (PMID: 21923916). Plasma FN1, or the dimeric form, is secreted by hepatocytes, whereas cellular FN1, the dimeric or cross-linked multimeric form, is produced by fibroblasts and epithelial cells and deposited as fibrils in the extracellular matrix.What are the post-translational modifications of FN1?FN1 is often sulfated and its C-terminal NC1 peptide, anastellin, is produced as a result of proteolytic processing and can inhibit tumor growth, angiogenesis, and metastasis by activating p38 MAPK and inhibiting lysophospholipid signaling (PMID: 11209058).What is FN1's role in embryogenesis?Fibronectin has a crucial role in the development of the left-right body axis during embryogenesis (PMID: 21466802).What is FN1's involvement in disease?Fibronectin glomerulopathy is a kidney disease that eventually leads to end-stage renal disease and is caused by mutations in the FN1 gene. Mutations in FN1 lead to the production of abnormal fibronectin protein that is deposited in the glomeruli of the kidney (PMID: 18268355).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit, bovine, hamster, sheep, medaka embryos\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8004 Product name: Recombinant human FN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2177-2386 aa of BC005858 Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE Predict reactive species\nFull Name: fibronectin 1\nCalculated Molecular Weight: 2386 aa, 263 kDa\nObserved Molecular Weight: 250-275 kDa\nGenBank Accession Number: BC005858\nGene Symbol: Fibronectin\nGene ID (NCBI): 2335\nRRID: AB_2105691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02751\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817969321,"sku":"15613-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15613-1-ap","provider":"Iright","version":"1.0","type":"link"}