{"product_id":"proteintech-15649-1-ap","title":"Proteintech, 15649-1-AP, IKKB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IKKB (15649-1-AP) by Proteintech is a Polyclonal antibody targeting IKKB in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15649-1-AP targets IKKB in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse brain tissue,  rat brain tissue,  rat lung tissue\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human liver cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIKBKB, also named as IKKB, IKK2, NFKBIKB and IKK-B, belongs to the protein kinase superfamily, Ser\/Thr protein kinase family and I-kappa-B kinase subfamily. IKBKB is a Serine kinase that plays an essential role in the NF-kappa-B signaling pathway. It acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. In addition to the NF-kappa-B inhibitors, IKBKB phosphorylates several other components of the signaling pathway including NEMO\/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. It also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, IKBKB acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation. This antibody can identify 4 isoform of IKBKB with the molecular weight of 80, 86, 87 and 29 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8191 Product name: Recombinant human IKBKB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC006231 Sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS Predict reactive species\nFull Name: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta\nCalculated Molecular Weight: 756aa,81 kDa; 256aa,29 kDa\nObserved Molecular Weight: 80 kDa, 86 kDa, 87 and 29 kDa\nGenBank Accession Number: BC006231\nGene Symbol: IKBKB\nGene ID (NCBI): 3551\nRRID: AB_2122307\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14920\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868827898025,"sku":"15649-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15649-1-ap","provider":"Iright","version":"1.0","type":"link"}