{"product_id":"proteintech-15672-1-ap","title":"Proteintech, 15672-1-AP, NFKBID Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFKBID (15672-1-AP) by Proteintech is a Polyclonal antibody targeting NFKBID in WB, ELISA applications with reactivity to human, mouse samples\n15672-1-AP targets NFKBID in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A20 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFKBID, also known as IkBNS, belongs to the IKB protein family of NFKB inhibitors and is induced by T-cell receptor stimulation(PMID: 11931770). NFKBID regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. NFKBID plays a role in regulating inflammatory responses. NFKBID is involved in the induction of T helper 17 cells (Th17) differentiation upon antigen recognition by T cell antigen receptor (TCR). (PMID: 25347393)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8139 Product name: Recombinant human NFKBID protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC006273 Sequence: MRSCCVVQAGLQLLASSDPPSSASQSARITGVNHRTPPREIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS Predict reactive species\nFull Name: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, delta\nCalculated Molecular Weight: 150 aa, 16 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC006273\nGene Symbol: NFKBID\nGene ID (NCBI): 84807\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NI38\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887736180905,"sku":"15672-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15672-1-ap","provider":"Iright","version":"1.0","type":"link"}