{"product_id":"proteintech-15683-1-ap","title":"Proteintech, 15683-1-AP, GMPR 1\/2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GMPR 1\/2 (15683-1-AP) by Proteintech is a Polyclonal antibody targeting GMPR 1\/2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15683-1-AP targets GMPR 1\/2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGMPR (Guanosine monophosphate reductase) catalyzes the irreversible NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). GMPR is able to convert guanosine nucleotides to the pivotal precursor of both guanine (G) and adenine (A) nucleotides. It plays an important role in maintaining the intracellular balance of A and G nucleotides. This antibody can recognize both GMPR1 and GMPR2 due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8185 Product name: Recombinant human GMPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC008281 Sequence: MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS Predict reactive species\nFull Name: guanosine monophosphate reductase\nCalculated Molecular Weight: 345 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC008281\nGene Symbol: GMPR\nGene ID (NCBI): 2766\nRRID: AB_2111072\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36959\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998586537,"sku":"15683-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15683-1-ap","provider":"Iright","version":"1.0","type":"link"}