{"product_id":"proteintech-15684-1-ap","title":"Proteintech, 15684-1-AP, REEP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REEP2 (15684-1-AP) by Proteintech is a Polyclonal antibody targeting REEP2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n15684-1-AP targets REEP2 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human heart tissue,  mouse eye tissue,  human skeletal muscle tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8186 Product name: Recombinant human REEP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-252 aa of BC006218 Sequence: IAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA Predict reactive species\nFull Name: receptor accessory protein 2\nCalculated Molecular Weight: 252 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC006218\nGene Symbol: REEP2\nGene ID (NCBI): 51308\nRRID: AB_2238326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908343465,"sku":"15684-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15684-1-ap","provider":"Iright","version":"1.0","type":"link"}