{"product_id":"proteintech-15687-1-ap","title":"Proteintech, 15687-1-AP, DLG5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLG5 (15687-1-AP) by Proteintech is a Polyclonal antibody targeting DLG5 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n15687-1-AP targets DLG5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, mouse kidney tissue,  HeLa cells\nPositive IHC detected in: Human bowens diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDiscs large homolog 5 (DLG5) belongs to the membrane-associated guanylate kinase (MAGUK) family. DLG5 participates in epithelial cell polarity maintenance and cancer development. DLG5 is highly expressed in normal tissues, but its expression is decreased in many cancers, such as bladder cancer, prostate cancer, breast cancer, and hepatocellular carcinoma (PMID: 32015336). Down-regulation of DLG5 is highly correlated with clinical tumor stage. In breast cancer, knockdown of DLG5 induces cell migration, and overexpression of DLG5 inhibits cell migration (PMID: 28169360). DLG5 has 3 isoforms with the molecular weight of 75, 214 and 240 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8194 Product name: Recombinant human DLG5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1569-1919 aa of BC002915 Sequence: VRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGRCAWAWSGEQAAGKEAEAS Predict reactive species\nFull Name: discs, large homolog 5 (Drosophila)\nCalculated Molecular Weight: 1893 aa, 209 kDa\nObserved Molecular Weight: 75 kDa, 240 kDa\nGenBank Accession Number: BC002915\nGene Symbol: DLG5\nGene ID (NCBI): 9231\nRRID: AB_10642568\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDM6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869674918057,"sku":"15687-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15687-1-ap","provider":"Iright","version":"1.0","type":"link"}