{"product_id":"proteintech-15698-1-ap","title":"Proteintech, 15698-1-AP, CLPP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLPP (15698-1-AP) by Proteintech is a Polyclonal antibody targeting CLPP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15698-1-AP targets CLPP in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, rat heart tissue,  K-562 cells,  mouse heart tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human liver cancer tissue, human kidney tissue,  human testis tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. This protein has a transit peptide of 56 amino acid.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken, zebrafish, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8325 Product name: Recombinant human CLPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC002956 Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST Predict reactive species\nFull Name: ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 26 kDa, 30 kDa\nGenBank Accession Number: BC002956\nGene Symbol: CLPP\nGene ID (NCBI): 8192\nRRID: AB_2245115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16740\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839727273,"sku":"15698-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15698-1-ap","provider":"Iright","version":"1.0","type":"link"}