{"product_id":"proteintech-15707-1-ap","title":"Proteintech, 15707-1-AP, L2HGDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe L2HGDH (15707-1-AP) by Proteintech is a Polyclonal antibody targeting L2HGDH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15707-1-AP targets L2HGDH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, rat brain tissue,  mouse small intestine tissue,  SGC-7901 cells,  MCF-7 cells\nPositive IHC detected in: human liver cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nL2HGDH(L-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as duranin, C14orf160 and belongs to the L2HGDH family. The putative L2HGDH is predicted to be targeted to the mitochondria where its mitochondrial targeting sequence is presumably removed(PMID:16005139). Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA). It has 2 isoforms produced by alternative splicing with the molecular weight of 50 kDa and 48 kDa. L2HGDH also can be detected as ~45kD due to the 51aa transit peptide cleaved.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8382 Product name: Recombinant human L2HGDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC006117 Sequence: MVPALRYLVGACGRARGRFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDI Predict reactive species\nFull Name: L-2-hydroxyglutarate dehydrogenase\nCalculated Molecular Weight: 463aa,50 kDa; 441aa,49 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC006117\nGene Symbol: L2HGDH\nGene ID (NCBI): 79944\nRRID: AB_2133202\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H9P8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868885307561,"sku":"15707-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15707-1-ap","provider":"Iright","version":"1.0","type":"link"}