{"product_id":"proteintech-15714-1-ap","title":"Proteintech, 15714-1-AP, NARS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NARS2 (15714-1-AP) by Proteintech is a Polyclonal antibody targeting NARS2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15714-1-AP targets NARS2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human liver tissue,  human brain tissue,  K-562 cells,  mouse kidney tissue\nPositive IHC detected in: human kidney tissue, human heart tissue,  human lung tissue,  human placenta tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNARS2 (asparaginyl-tRNA synthetase 2, mitochondrial) is a nuclear-encoded enzyme that functions within the mitochondria, the energy-producing organelles of the cell. It belongs to the class II family of aminoacyl-tRNA synthetases (aaRSs), a group of essential enzymes responsible for protein synthesis. Its proper function is indispensable for mitochondrial protein synthesis and energy production, and its deficiency underlies a spectrum of severe human metabolic and neurological diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8345 Product name: Recombinant human NARS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-477 aa of BC007800 Sequence: ERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL Predict reactive species\nFull Name: asparaginyl-tRNA synthetase 2, mitochondrial (putative)\nCalculated Molecular Weight: 477 aa, 54 kDa\nObserved Molecular Weight: 50-54 kDa\nGenBank Accession Number: BC007800\nGene Symbol: NARS2\nGene ID (NCBI): 79731\nRRID: AB_2151157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96I59\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887732445353,"sku":"15714-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15714-1-ap","provider":"Iright","version":"1.0","type":"link"}