{"product_id":"proteintech-15734-1-ap","title":"Proteintech, 15734-1-AP, MIA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIA (15734-1-AP) by Proteintech is a Polyclonal antibody targeting MIA in IHC, ELISA applications with reactivity to human, mouse, rat samples\n15734-1-AP targets MIA in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human skin cancer tissue,  human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMelanoma-derived growth regulatory protein, also known as MIA, CD RAP, is a protein that in humans is encoded by the MIA gene. It is a marker for malignant melanoma (PMID: 9242442).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8499 Product name: Recombinant human MIA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-131 aa of BC005910 Sequence: GGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ Predict reactive species\nFull Name: melanoma inhibitory activity\nCalculated Molecular Weight: 131 aa, 15 kDa\nGenBank Accession Number: BC005910\nGene Symbol: MIA\nGene ID (NCBI): 8190\nRRID: AB_2878176\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16674\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869709652137,"sku":"15734-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15734-1-ap","provider":"Iright","version":"1.0","type":"link"}