{"product_id":"proteintech-15746-1-ap","title":"Proteintech, 15746-1-AP, ALDH3B2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALDH3B2 (15746-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH3B2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15746-1-AP targets ALDH3B2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue,  BxPC-3 cells,  HepG2 cells\nPositive IHC detected in: human adrenal gland tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALDH3B2(aldehyde dehydrogenase family 3 member B2) is also named as ALDH8(aldehyde dehydrogenase 8) and belongs to the aldehyde dehydrogenase family. The ALDH3B2 gene contains an in-frame stop codon at the seventeenth codon position from the first methionine,suggesting that ALDH3B2 may be a pseudogene(PMID:15237855) and encodes the human salivary gland and placental ALDH(PMID: 22206977). This protein shares 83% sequence identity with ALDH3B1(PMID:18611112 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8197 Product name: Recombinant human ALDH3B2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-385 aa of BC007685 Sequence: TGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL Predict reactive species\nFull Name: aldehyde dehydrogenase 3 family, member B2\nCalculated Molecular Weight: 395 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC007685\nGene Symbol: ALDH3B2\nGene ID (NCBI): 222\nRRID: AB_2242461\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48448\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869392490665,"sku":"15746-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15746-1-ap","provider":"Iright","version":"1.0","type":"link"}