{"product_id":"proteintech-15761-1-ap","title":"Proteintech, 15761-1-AP, CHMP1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHMP1A (15761-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP1A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n15761-1-AP targets CHMP1A in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse lung tissue,  HeLa cells,  A431 cells,  mouse kidney tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse brain tissue, human lung tissue,  mouse testis tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCharged multivesicular body protein 1A (CHMP1A), also known as chromatin modifying protein 1A, is a member of the ESCRT-III (endosomal sorting complex required for transport III) complex which is involved in degradation of internalized transmembrane receptor proteins and formation of multivesicular bodies (MVBs) (PMID: 16730941). CHMP1A has both nuclear and cytoplasmic distributions (PMID: 11559748; 11559747). Subcellular localization of CHMP1A seems to vary depending on the cell type (PMID: 23023333). CHMP1A is required for MVBs formation and has a role in stable gene silencing within the nucleus. Besides, the tumor suppressor role of CHMP1A has also been reported (PMID: 18787405; 22261332).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8389 Product name: Recombinant human CHMP1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC007527 Sequence: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN Predict reactive species\nFull Name: chromatin modifying protein 1A\nCalculated Molecular Weight: 196 aa, 22 kDa\nObserved Molecular Weight: 33 kDa, 25 kDa\nGenBank Accession Number: BC007527\nGene Symbol: CHMP1A\nGene ID (NCBI): 5119\nRRID: AB_2229399\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HD42\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868923515049,"sku":"15761-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15761-1-ap","provider":"Iright","version":"1.0","type":"link"}