{"product_id":"proteintech-15775-1-ap","title":"Proteintech, 15775-1-AP, HTRA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HTRA2 (15775-1-AP) by Proteintech is a Polyclonal antibody targeting HTRA2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples\n15775-1-AP targets HTRA2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HAP1 cells,  human heart tissue,  mouse skeletal muscle tissue,  Raji cells,  MCF-7 cells,  Jurkat cells,  HEK-293 cells,  SH-SY5Y cells,  COS-7 cells,  Neuro-2a cells\nPositive IP detected in: Raji cells\nPositive IHC detected in: human kidney tissue,  human colon tissue,  human thyroid tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHTRA2(High temperature requirement protein A2) is also named as OMI, PRSS25 and belongs to the peptidase S1B family. HTRA2 normally exists in the mitochondria, can cause MMP3 activation in the cytosol under a cell stress condition, which can ultimately lead to demise of dopaminergic neuronal cells(PMID: 22265821). It inhibits mitochondrial superoxide generation, stabilizes mitochondrial membrane potential, and prevents apoptosis at baseline and in response to extracellular inducers of mitochondrial stress(PMID: 18772386). This protein has 4 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse, rat, monkey, chicken, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8455 Product name: Recombinant human HTRA2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 133-458 aa of BC000096 Sequence: AAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE Predict reactive species\nFull Name: HtrA serine peptidase 2\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC000096\nGene Symbol: HTRA2\nGene ID (NCBI): 27429\nRRID: AB_2122835\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43464\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869447849,"sku":"15775-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15775-1-ap","provider":"Iright","version":"1.0","type":"link"}