{"product_id":"proteintech-15783-1-ap","title":"Proteintech, 15783-1-AP, UFC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UFC1 (15783-1-AP) by Proteintech is a Polyclonal antibody targeting UFC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15783-1-AP targets UFC1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  MCF-7 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe function of UFC1 (ubiquitin fold modifier conjugating enzyme 1) has not been widely studied, and is yet to be fully elucidated. The MW of this protein is 21 kDa, and this antibody specially recognises the 21 kDa protein. Catalog#15783-1-AP specially recognises the 21 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8480 Product name: Recombinant human UFC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC005187 Sequence: MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITCPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ Predict reactive species\nFull Name: ubiquitin-fold modifier conjugating enzyme 1\nCalculated Molecular Weight: 167 aa, 19 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC005187\nGene Symbol: UFC1\nGene ID (NCBI): 51506\nRRID: AB_2213938\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3C8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937998505,"sku":"15783-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15783-1-ap","provider":"Iright","version":"1.0","type":"link"}