{"product_id":"proteintech-15789-1-ap","title":"Proteintech, 15789-1-AP, PIN4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIN4 (15789-1-AP) by Proteintech is a Polyclonal antibody targeting PIN4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15789-1-AP targets PIN4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  HeLa cells,  mouse brain tissue,  mouse kidney tissue\nPositive IHC detected in: human liver cancer tissue, human kidney tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIN4, also known as EPVH, hPar14, is a member of the parvulin subfamily of the peptidyl-prolyl cis\/trans isomerase protein family. PIN4 is the first eukaryotic member of the parvulin family of PPIases and contains a PPIase domain preceded by a 40-amino acid glycine- and lysine-rich N-terminal sequence.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8489 Product name: Recombinant human PIN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-140 aa of BC005234 Sequence: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK Predict reactive species\nFull Name: protein (peptidylprolyl cis\/trans isomerase) NIMA-interacting, 4 (parvulin)\nCalculated Molecular Weight: 131 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC005234\nGene Symbol: PIN4\nGene ID (NCBI): 5303\nRRID: AB_2878186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y237\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869730689193,"sku":"15789-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15789-1-ap","provider":"Iright","version":"1.0","type":"link"}