{"product_id":"proteintech-15790-1-ap","title":"Proteintech, 15790-1-AP, TNFAIP8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNFAIP8 (15790-1-AP) by Proteintech is a Polyclonal antibody targeting TNFAIP8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15790-1-AP targets TNFAIP8 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, A549 cells,  PC-13 cells,  MOLT-4 cells\nPositive IHC detected in: human lung cancer tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNFAIP8 (tumor necrosis factor, alpha-induced protein 8), also called SCC-S2\/GG2-1\/NDED, is associated with enhanced cell survival and inhibition of apoptosis. The induction of TNFAIP8 by TNF depends on the activation of NFκB. TNFAIP8 suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. TNFAIP8 is expressed in adult spleen, lymph node, thymus, thyroid, bone marrow, and placenta, and in fetal liver, lung, and kidney at high levels, also expressed in various tumor tissues and all cancer cell lines tested. There are four major isoforms of TNFAIP8.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8491 Product name: Recombinant human TNFAIP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC007014 Sequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI Predict reactive species\nFull Name: tumor necrosis factor, alpha-induced protein 8\nCalculated Molecular Weight: 198 aa, 23 kDa\nObserved Molecular Weight: 19-23 kDa\nGenBank Accession Number: BC007014\nGene Symbol: TNFAIP8\nGene ID (NCBI): 25816\nRRID: AB_10792805\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95379\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899627177,"sku":"15790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15790-1-ap","provider":"Iright","version":"1.0","type":"link"}