{"product_id":"proteintech-15796-1-ap","title":"Proteintech, 15796-1-AP, BAP29 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAP29 (15796-1-AP) by Proteintech is a Polyclonal antibody targeting BAP29 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n15796-1-AP targets BAP29 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, COLO 320 cells,  Raji cells,  U-87 MG cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8505 Product name: Recombinant human BCAP29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-241 aa of BC008478 Sequence: RRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL Predict reactive species\nFull Name: B-cell receptor-associated protein 29\nCalculated Molecular Weight: 241 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC008478\nGene Symbol: BAP29\nGene ID (NCBI): 55973\nRRID: AB_2065118\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHQ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869642051753,"sku":"15796-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15796-1-ap","provider":"Iright","version":"1.0","type":"link"}