{"product_id":"proteintech-15802-1-ap","title":"Proteintech, 15802-1-AP, NHP2L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NHP2L1 (15802-1-AP) by Proteintech is a Polyclonal antibody targeting NHP2L1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15802-1-AP targets NHP2L1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  mouse pancreas tissue,  HepG2 cells,  Jurkat cells,  SH-SY5Y cells,  mouse brain tissue,  rat brain tissue,  MCF-7 cells\nPositive IHC detected in: human cervical cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNHP2L1, belongs to the ribosomal protein L7Ae family, is a component of the spliceosome complex. It is recruited to introns following the attachment of U4 and U6 RNAs, and is required for subsequent recruitment of PRP31 and activation of the spliceosomal complex [PMID: 17412961]. It binds to the 5'-stem-loop of U4 snRNA and may have a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding [PMID: 10545122].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8532 Product name: Recombinant human NHP2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC005358 Sequence: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV Predict reactive species\nFull Name: NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)\nCalculated Molecular Weight: 128 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC005358\nGene Symbol: NHP2L1\nGene ID (NCBI): 4809\nRRID: AB_2251452\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55769\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005762729,"sku":"15802-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15802-1-ap","provider":"Iright","version":"1.0","type":"link"}