{"product_id":"proteintech-15803-1-ap","title":"Proteintech, 15803-1-AP, Calpain S2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calpain S2 (15803-1-AP) by Proteintech is a Polyclonal antibody targeting Calpain S2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15803-1-AP targets Calpain S2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue,  rat skin tissue\nPositive IP detected in: mouse skin tissue\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalpain S2, also known as calpain-2, is a member of the calpain family of calcium-dependent proteases that play crucial roles in various cellular processes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8534 Product name: Recombinant human CAPNS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-248 aa of BC005397 Sequence: KALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS Predict reactive species\nFull Name: calpain, small subunit 2\nCalculated Molecular Weight: 248 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC005397\nGene Symbol: Calpain S2\nGene ID (NCBI): 84290\nRRID: AB_2259580\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96L46\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885775147177,"sku":"15803-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15803-1-ap","provider":"Iright","version":"1.0","type":"link"}