{"product_id":"proteintech-15806-1-ap","title":"Proteintech, 15806-1-AP, GRIPAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRIPAP1 (15806-1-AP) by Proteintech is a Polyclonal antibody targeting GRIPAP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15806-1-AP targets GRIPAP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRIP-associated protein-1 (GRASP-1), also named as GRIPAP1, is a neuron-specific effector of the small GTPase Rab4 and key component of AMPA receptor recycling machinery in dendrites. GRASP-1 is essential for maintenance of spine morphology and important for LTP. GRASP-1 connects Rab4 and Rab11 recycling endosomal domains through the interaction with target (t)-SNARE syntaxin. The MW of this protein is 97 kDa, and Catalog#15806-1-AP specially recognises the 97 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8540 Product name: Recombinant human GRIPAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-587 aa of BC001522 Sequence: QEERDCHLKTISSLKQEVKDTVDGQRILEKKGSAALKDLKRQLHLERKRADKLQERLQDILTNSKSRSGLEELVLSEMNSPSRTQTGDSSSISSFSYREILREKESSAVPARSLSSSPQAQPPRPAELSDEEVAELFQRLAETQQEKWMLEEKVKHLEVSSASMAEDLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGPPDPDLEPGETS Predict reactive species\nFull Name: GRIP1 associated protein 1\nCalculated Molecular Weight: 841 aa, 96 kDa\nObserved Molecular Weight: 97 kDa\nGenBank Accession Number: BC001522\nGene Symbol: GRIPAP1\nGene ID (NCBI): 56850\nRRID: AB_2112787\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4V328\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869690187945,"sku":"15806-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15806-1-ap","provider":"Iright","version":"1.0","type":"link"}