{"product_id":"proteintech-15809-1-ap","title":"Proteintech, 15809-1-AP, DNAL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAL1 (15809-1-AP) by Proteintech is a Polyclonal antibody targeting DNAL1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n15809-1-AP targets DNAL1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNAL1 was originally documented as the Chlamydomonas outer arm dynein axonemal light chain 1. DNAL1 has been documented to link components of the cytoskeleton with the molecular motor dynein, perhaps acting as a scaffold for larger functional structures (PMID: 22018492).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8545 Product name: Recombinant human DNAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC005343 Sequence: MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN Predict reactive species\nFull Name: dynein, axonemal, light chain 1\nCalculated Molecular Weight: 151 aa, 17 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC005343\nGene Symbol: DNAL1\nGene ID (NCBI): 83544\nRRID: AB_2095365\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4LDG9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887264616617,"sku":"15809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15809-1-ap","provider":"Iright","version":"1.0","type":"link"}