{"product_id":"proteintech-15811-1-ap","title":"Proteintech, 15811-1-AP, Centrin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Centrin 3 (15811-1-AP) by Proteintech is a Polyclonal antibody targeting Centrin 3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n15811-1-AP targets Centrin 3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells, C2C12 cells,  Neuro-2a cells,  mouse ovary tissue,  mouse testis tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCentrin 3 protein is a highly conserved calcium-binding protein that belongs to the EF-hand calcium-binding protein superfamily and contains four calcium-binding domains. It is primarily located in structures associated with the microtubule-organizing center within cells. Centrin 3 plays a crucial role in centriole duplication, which is essential for the bipolarity of cell division. Additionally, Centrin 3 is involved in inhibiting the activity of the centrosomal Mps1 kinase and has an antagonistic relationship with the function of Centrin 2. Recent studies have shown that CETN3 interacts with USP49 to participate in RNA splicing processes in neural stem\/progenitor cells, thereby indirectly affecting the cell cycle and neural development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8547 Product name: Recombinant human CETN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC005383 Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI Predict reactive species\nFull Name: centrin, EF-hand protein, 3 (CDC31 homolog, yeast)\nCalculated Molecular Weight: 167 aa, 20 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC005383\nGene Symbol: Centrin 3\nGene ID (NCBI): 1070\nRRID: AB_2082361\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15182\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869655126185,"sku":"15811-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15811-1-ap","provider":"Iright","version":"1.0","type":"link"}