{"product_id":"proteintech-15849-1-ap","title":"Proteintech, 15849-1-AP, NDUFS4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFS4 (15849-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFS4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15849-1-AP targets NDUFS4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFS4 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 4 mitochondrial), also known as AQDQ, is a member of NADH dehydrogenase (ubiquinone) iron-sulfur (NDUFS) protein family. It is a peripheral membrane protein located on the matrix side of the inner mitochondrial membrane. It is reported that the loss of NDUFS4 protein expression in immunohistochemistry (IHC) reliably diagnoses papillary thyroid carcinoma(PMID: 34792302). Also, NDUFS4 promotes tumor progression and predicts prognosis in gastric cancer(PMID: 36044738).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8633 Product name: Recombinant human NDUFS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC005270 Sequence: MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)\nCalculated Molecular Weight: 175 aa, 20 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC005270\nGene Symbol: NDUFS4\nGene ID (NCBI): 4724\nRRID: AB_2878191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43181\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943175849,"sku":"15849-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15849-1-ap","provider":"Iright","version":"1.0","type":"link"}