{"product_id":"proteintech-15854-1-ap","title":"Proteintech, 15854-1-AP, ABHD17A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABHD17A (15854-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD17A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15854-1-AP targets ABHD17A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, SH-SY5Y cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha\/beta hydrolase domain-containing protein 17A (ABHD17A) is a membrane-localized thioesterase, which regulates H- and N-RAS39, also catalyzes the depalmitoylation of CNAβ1 causing it to redistribute from the PM to the cytosol and the Golgi (PMID: 34663815). ABHD17a is a major acyl protein thioesterase that site-specifically deacylates the STREX domain of the BK channel to control channel activity (PMID: 32913120). Western blot analysis detected ABHD17A at an apparent molecular mass of 34 kDa (PMID: 27307232), and the 70 kDa-band could be the dimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8697 Product name: Recombinant human FAM108A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC000158 Sequence: MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNHVSCMYVRCVPGARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPK Predict reactive species\nFull Name: family with sequence similarity 108, member A1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC000158\nGene Symbol: ABHD17A\nGene ID (NCBI): 81926\nRRID: AB_2878193\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96GS6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869391474857,"sku":"15854-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15854-1-ap","provider":"Iright","version":"1.0","type":"link"}