{"product_id":"proteintech-15874-1-ap","title":"Proteintech, 15874-1-AP, Glycophorin A\/CD235a Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Glycophorin A\/CD235a (15874-1-AP) by Proteintech is a Polyclonal antibody targeting Glycophorin A\/CD235a in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n15874-1-AP targets Glycophorin A\/CD235a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: human spleen tissue, human colon cancer tissue,  human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid\/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8635 Product name: Recombinant human GYPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-150 aa of BC005319 Sequence: EVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ Predict reactive species\nFull Name: glycophorin A (MNS blood group)\nCalculated Molecular Weight: 150 aa, 16 kDa\nObserved Molecular Weight: 36-38 kDa\nGenBank Accession Number: BC005319\nGene Symbol: Glycophorin A\nGene ID (NCBI): 2993\nRRID: AB_2116233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02724\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887652524201,"sku":"15874-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15874-1-ap","provider":"Iright","version":"1.0","type":"link"}