{"product_id":"proteintech-15879-1-ap","title":"Proteintech, 15879-1-AP, LSM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSM3 (15879-1-AP) by Proteintech is a Polyclonal antibody targeting LSM3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15879-1-AP targets LSM3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLSM3, as a U6 snRNA-associated Sm-like protein, plays a role in pre-mRNA splicing as component of the U4\/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8641 Product name: Recombinant human LSM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC007055 Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG Predict reactive species\nFull Name: LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)\nCalculated Molecular Weight: 102 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC007055\nGene Symbol: LSM3\nGene ID (NCBI): 27258\nRRID: AB_3669222\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62310\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887709212841,"sku":"15879-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15879-1-ap","provider":"Iright","version":"1.0","type":"link"}