{"product_id":"proteintech-15901-1-ap","title":"Proteintech, 15901-1-AP, ACOT9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACOT9 (15901-1-AP) by Proteintech is a Polyclonal antibody targeting ACOT9 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n15901-1-AP targets ACOT9 in WB, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  mouse heart tissue,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: mouse kidney tissue, human kidney tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACOT9 (Acyl-coenzyme A thioesterase 9) is a member of the acyl-CoA thioesterase superfamily, which is a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. ACOT9 has 4 isoforms with the molecular mass of 43-50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8730 Product name: Recombinant human ACOT9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC012573 Sequence: MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG Predict reactive species\nFull Name: acyl-CoA thioesterase 9\nCalculated Molecular Weight: 24 kDa, 49 kDa\nObserved Molecular Weight: 43-50 kDa\nGenBank Accession Number: BC012573\nGene Symbol: ACOT9\nGene ID (NCBI): 23597\nRRID: AB_2221519\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y305\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869511930025,"sku":"15901-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15901-1-ap","provider":"Iright","version":"1.0","type":"link"}