{"product_id":"proteintech-15911-1-ap","title":"Proteintech, 15911-1-AP, KIF20A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF20A (15911-1-AP) by Proteintech is a Polyclonal antibody targeting KIF20A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15911-1-AP targets KIF20A in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HeLa cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF20A, also known as RAB6KIFL or MKlp2, is a kinesin originally identified as a binding partner for the rab6 GTPase involved in protein transport at the Golgi apparatus. KIF20A belongs to a large family of motor proteins that accumulate in mitotic cells and is required for normal cell division. KIF20A is thought to be involved in carcinogenesis. In normal tissues KIF20A is almost undetectable while it is overexpressed in various cancers. KIF20A has been identified as a novel  promising candidate for anticancer immunotherapy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8700 Product name: Recombinant human KIF20A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC012999 Sequence: MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQD Predict reactive species\nFull Name: kinesin family member 20A\nCalculated Molecular Weight: 890 aa, 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC012999\nGene Symbol: KIF20A\nGene ID (NCBI): 10112\nRRID: AB_2131434\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95235\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906737833,"sku":"15911-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15911-1-ap","provider":"Iright","version":"1.0","type":"link"}