{"product_id":"proteintech-15912-1-ap","title":"Proteintech, 15912-1-AP, UBE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE1 (15912-1-AP) by Proteintech is a Polyclonal antibody targeting UBE1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15912-1-AP targets UBE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  HEK-293 cells,  mouse spleen tissue,  rat spleen tissue,  mouse colon tissue\nPositive IHC detected in: human colon cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:1500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE1(Ubiquitin-activating enzyme E1) is also named as A1S9T, UBE1 and belongs to the ubiquitin-activating E1 family. It catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation and initiates the activation and conjugation of ubiquitin-like proteins. Defects in UBE1 are the cause of spinal muscular atrophy X-linked type 2 (SMAX2). UBE1 has two isoforms with the molecular mass of 118 and 114 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8703 Product name: Recombinant human UBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-1058 aa of BC013041 Sequence: CHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR Predict reactive species\nFull Name: ubiquitin-like modifier activating enzyme 1\nCalculated Molecular Weight: 1058 aa, 118 kDa\nObserved Molecular Weight: 114-118 kDa\nGenBank Accession Number: BC013041\nGene Symbol: UBA1\nGene ID (NCBI): 7317\nRRID: AB_2211462\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22314\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909523113,"sku":"15912-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15912-1-ap","provider":"Iright","version":"1.0","type":"link"}