{"product_id":"proteintech-15914-1-ap","title":"Proteintech, 15914-1-AP, CTP synthase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTP synthase (15914-1-AP) by Proteintech is a Polyclonal antibody targeting CTP synthase in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n15914-1-AP targets CTP synthase in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Raji cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTP synthase(CTPS) is also named as CTPS1 and belongs to the CTP synthase family. It catalyses the ATP-dependent formation of CTP from UTP using either L-glutamine or NH3 as the nitrogen source(PMID:12752439). It is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis (PMID:8813694).  CTP synthetase exists as a dimer in the absence of its substrates ATP and UTP, but in the presence of saturating concentrations of these substrates the enzyme exists as a tetramer.(PMID:18439916)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, zebrafish, mosquito\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8707 Product name: Recombinant human CTPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-591 aa of BC009408 Sequence: ICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRIGSSSPDSEITELKFPSINHD Predict reactive species\nFull Name: CTP synthase\nCalculated Molecular Weight: 591 aa, 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC009408\nGene Symbol: CTPS\nGene ID (NCBI): 1503\nRRID: AB_2086513\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17812\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868867580073,"sku":"15914-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15914-1-ap","provider":"Iright","version":"1.0","type":"link"}