{"product_id":"proteintech-15923-1-ap","title":"Proteintech, 15923-1-AP, POLR1C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLR1C (15923-1-AP) by Proteintech is a Polyclonal antibody targeting POLR1C in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n15923-1-AP targets POLR1C in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HEK-293 cells,  Caco-2 cells,  HeLa cells,  HepG2 cells\nPositive IP detected in: NIH\/3T3 cells\nPositive IHC detected in: human ovary tissue, mouse liver tissue,  human heart tissue,  human kidney tissue,  human placenta tissue,  human testis tissue,  human skin tissue,  human liver tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOLR1C is a DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. It is a common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8746 Product name: Recombinant human POLR1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-346 aa of BC008863 Sequence: MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD Predict reactive species\nFull Name: polymerase (RNA) I polypeptide C, 30kDa\nCalculated Molecular Weight: 346 aa, 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC008863\nGene Symbol: POLR1C\nGene ID (NCBI): 9533\nRRID: AB_2167328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15160\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869575303337,"sku":"15923-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15923-1-ap","provider":"Iright","version":"1.0","type":"link"}