{"product_id":"proteintech-15941-1-ap","title":"Proteintech, 15941-1-AP, TMEM50B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM50B (15941-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM50B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15941-1-AP targets TMEM50B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, mouse heart tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM50B, originally referred to as C21orf4, is a predicted transmembrane protein, estimated to contain four transmembrane-spanning domains with both the carboxy- and amino-terminals being cytoplasmic (PMID: 10077530; 18541381). Human TMEM50B shares sequence homologies of around 90-100% with mouse and rat Tmem50b. In a Down syndrome mouse model, Ts1Cje, Tmem50b is shown to be one of the few genes significantly over-expressed during cerebellar development (PMID: 15590701). It has been reported that rodent Tmem50b is a developmentally-regulated intracellular ER and Golgi apparatus membrane protein that may prove important for correct brain development through functions associated with precursor cells and glia (PMID: 18541381). TMEM50B can exist as a dimer and a trimer conformation (PMID: 18541381).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8220 Product name: Recombinant human TMEM50B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC000569 Sequence: MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT Predict reactive species\nFull Name: transmembrane protein 50B\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 14 kDa, 30 kDa, 50 kDa\nGenBank Accession Number: BC000569\nGene Symbol: TMEM50B\nGene ID (NCBI): 757\nRRID: AB_2205161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56557\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887832977577,"sku":"15941-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15941-1-ap","provider":"Iright","version":"1.0","type":"link"}