{"product_id":"proteintech-15950-1-ap","title":"Proteintech, 15950-1-AP, UTP23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UTP23 (15950-1-AP) by Proteintech is a Polyclonal antibody targeting UTP23 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15950-1-AP targets UTP23 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUTP23 is a component of ribosomal small-subunit processome, which is involved in ribosome synthesis and RNA maturation. UTP23 contains a long and likely unstructured tail at the C terminus of the PIN domain (PMID: 24152547). UTP23 is a target of genetic variation associated with colorectal cancer in chromosome 8q23.3, and it may coordinate with EIF3H in this region in the development of colorectal cancer. Low expression of UTP23 predicts poorer prognosis of ovarian cancer patients (PMID: 31540773, 37880005). It has 2 predicted molecular weight of 28 kDa and 17 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8609 Product name: Recombinant human UTP23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC005955 Sequence: MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKRRKRKRIRNRSNPKVLSEKQNAEGE Predict reactive species\nFull Name: UTP23, small subunit (SSU) processome component, homolog (yeast)\nCalculated Molecular Weight: 249 aa, 28 kDa\nObserved Molecular Weight: 28 kDa, 17 kDa\nGenBank Accession Number: BC005955\nGene Symbol: UTP23\nGene ID (NCBI): 84294\nRRID: AB_10644292\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRU9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869791801513,"sku":"15950-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15950-1-ap","provider":"Iright","version":"1.0","type":"link"}