{"product_id":"proteintech-15964-1-ap","title":"Proteintech, 15964-1-AP, BNIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BNIP1 (15964-1-AP) by Proteintech is a Polyclonal antibody targeting BNIP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15964-1-AP targets BNIP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse skeletal muscle tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBNIP1 is a member of the BCL2\/adenovirus E1B 19 kDa-interacting protein (BNIP) family. The encoded protein is predominantly localized to the endoplasmic reticulum (ER), is a pro-apoptotic Bcl-2 homology domain 3 (BH3)-only protein. BNIP1, also called SEC20L, is a component of a SNARE complex consisting of STX18, USE1L, BNIP1\/SEC20L and SEC22B which is involved in apoptosis and ER membrane fusion. Recent reports showed that expression of BNIP1 induced mitochondrial fragmentation in a BH3 domain-dependent manner via increasing dynamin-related protein 1 (Drp1) expression. RNF185 is a mitochondrial ubiquitin E3 ligase that regulates selective mitochondrial autophagy, BNIP1 colocalizes with RNF185 at mitochondria and is polyubiquitinated by RNF185 through K63-based ubiquitin linkage in vivo and modulatemitochondrial homeostasis through autophagy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8737 Product name: Recombinant human BNIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-228 aa of BC010959 Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL Predict reactive species\nFull Name: BCL2\/adenovirus E1B 19kDa interacting protein 1\nCalculated Molecular Weight: 228 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC010959\nGene Symbol: BNIP1\nGene ID (NCBI): 662\nRRID: AB_2066636\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12981\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993474729,"sku":"15964-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15964-1-ap","provider":"Iright","version":"1.0","type":"link"}