{"product_id":"proteintech-15970-1-ap","title":"Proteintech, 15970-1-AP, IMMP2L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IMMP2L (15970-1-AP) by Proteintech is a Polyclonal antibody targeting IMMP2L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15970-1-AP targets IMMP2L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human kidney tissue,  human heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8752 Product name: Recombinant human IMMP2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-110 aa of BC008497 Sequence: MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRDGRKLKRI Predict reactive species\nFull Name: IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae)\nCalculated Molecular Weight: 12 kDa, 20 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC008497\nGene Symbol: IMMP2L\nGene ID (NCBI): 83943\nRRID: AB_2233868\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96T52\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869698216105,"sku":"15970-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15970-1-ap","provider":"Iright","version":"1.0","type":"link"}