{"product_id":"proteintech-15981-1-ap","title":"Proteintech, 15981-1-AP, ISG15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ISG15 (15981-1-AP) by Proteintech is a Polyclonal antibody targeting ISG15 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n15981-1-AP targets ISG15 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  A549 cells,  MCF-7 cells,  PC-3 cells,  IFN alpha treated A459 cells,  HepG2 cells,  IFN alpha treated HepG2 cells\nPositive IHC detected in: human lung cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig, monkey, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8782 Product name: Recombinant human ISG15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009507 Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Predict reactive species\nFull Name: ISG15 ubiquitin-like modifier\nCalculated Molecular Weight: 165 aa, 18 kDa\nObserved Molecular Weight: 15-17 kDa\nGenBank Accession Number: BC009507\nGene Symbol: ISG15\nGene ID (NCBI): 9636\nRRID: AB_2126302\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05161\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868832288937,"sku":"15981-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15981-1-ap","provider":"Iright","version":"1.0","type":"link"}