{"product_id":"proteintech-15998-1-ap","title":"Proteintech, 15998-1-AP, STAU2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAU2 (15998-1-AP) by Proteintech is a Polyclonal antibody targeting STAU2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15998-1-AP targets STAU2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse kidney tissue,  mouse brain tissue,  mouse liver tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8482 Product name: Recombinant human STAU2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC008370 Sequence: MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQR Predict reactive species\nFull Name: staufen, RNA binding protein, homolog 2 (Drosophila)\nCalculated Molecular Weight: 570 aa, 62 kDa\nObserved Molecular Weight: 62-66 kDa\nGenBank Accession Number: BC008370\nGene Symbol: STAU2\nGene ID (NCBI): 27067\nRRID: AB_10863121\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NUL3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869608956073,"sku":"15998-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15998-1-ap","provider":"Iright","version":"1.0","type":"link"}