{"product_id":"proteintech-15999-1-ap","title":"Proteintech, 15999-1-AP, ATP5F1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP5F1 (15999-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5F1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n15999-1-AP targets ATP5F1 in WB, IHC, IF\/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, HeLa cells,  mouse skeletal muscle tissue,  mouse liver tissue\nPositive IHC detected in: human liver tissue,  human brain tissue,  human heart tissue,  human kidney tissue,  human skin tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP5F1(ATP synthase subunit b) belongs to the eukaryotic ATPase B chain family. The ATP5F1 gene encodes subunit B of the mitochondrial ATP synthase Fo unit, which contains 214-amino acid with a 42-amino acid import signal(PMID:1831354). Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8571 Product name: Recombinant human ATP5F1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-256 aa of BC005366 Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1\nCalculated Molecular Weight: 256 aa, 29 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC005366\nGene Symbol: ATP5F1\nGene ID (NCBI): 515\nRRID: AB_2258817\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24539\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862468265,"sku":"15999-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-15999-1-ap","provider":"Iright","version":"1.0","type":"link"}