{"product_id":"proteintech-16012-1-ap","title":"Proteintech, 16012-1-AP, ARL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL1 (16012-1-AP) by Proteintech is a Polyclonal antibody targeting ARL1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16012-1-AP targets ARL1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, K-562 cells,  HeLa cells,  mouse liver tissue,  HepG2 cells,  Neuro-2a cells,  C6 cells\nPositive IP detected in: Neuro-2a cells\nPositive IHC detected in: human stomach cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8770 Product name: Recombinant human ARL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC007000 Sequence: MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ Predict reactive species\nFull Name: ADP-ribosylation factor-like 1\nCalculated Molecular Weight: 181 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC007000\nGene Symbol: ARL1\nGene ID (NCBI): 400\nRRID: AB_2243131\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P40616\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910145705,"sku":"16012-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16012-1-ap","provider":"Iright","version":"1.0","type":"link"}