{"product_id":"proteintech-16058-1-ap","title":"Proteintech, 16058-1-AP, TSPAN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN1 (16058-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16058-1-AP targets TSPAN1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  COLO 320 cells,  rat colon tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN1 is a membrane protein of the tetraspanin superfamily, which is characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. Altered TSPAN1 expression has been associated with the progression of some neoplasms including hepatocellular carcinoma, colorectal, gastric, and breast cancers (PMID: 20890423; 19437569; 18822690; 20680643).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8786 Product name: Recombinant human TSPAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC013404 Sequence: MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV Predict reactive species\nFull Name: tetraspanin 1\nCalculated Molecular Weight: 241 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC013404\nGene Symbol: TSPAN1\nGene ID (NCBI): 10103\nRRID: AB_2878210\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60635\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869438496937,"sku":"16058-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16058-1-ap","provider":"Iright","version":"1.0","type":"link"}