{"product_id":"proteintech-16068-1-ap","title":"Proteintech, 16068-1-AP, GCDFP-15\/PIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GCDFP-15\/PIP (16068-1-AP) by Proteintech is a Polyclonal antibody targeting GCDFP-15\/PIP in IHC, ELISA applications with reactivity to human samples\n16068-1-AP targets GCDFP-15\/PIP in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissue, human skin tissue,  human breast tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGCDFP-15 (gross cystic disease fluid protein 15), also known as PIP (prolactin-induced protein) is a secretory glycoprotein expressed in benign and malignant breast tumor tissues and in some normal exocrine organs such as sweat, salivary, and lacrimal glands (PMID: 12393800). GCDFP-15 expression is increased by prolactin and androgen and inhibited by estrogen (PMID: 18854942). The expression is also regulated by interleukins. GCDFP-15 is a marker of apocrine differentiation and is frequently used for assessment of metastases or regional recurrences of breast origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9004 Product name: Recombinant human GCDFP-15, PIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-146 aa of BC010950 Sequence: AQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Predict reactive species\nFull Name: prolactin-induced protein\nCalculated Molecular Weight: 146 aa, 17 kDa\nGenBank Accession Number: BC010950\nGene Symbol: GCDFP-15\nGene ID (NCBI): 5304\nRRID: AB_2878212\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12273\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887648592041,"sku":"16068-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16068-1-ap","provider":"Iright","version":"1.0","type":"link"}