{"product_id":"proteintech-16090-1-ap","title":"Proteintech, 16090-1-AP, GNB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNB2 (16090-1-AP) by Proteintech is a Polyclonal antibody targeting GNB2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n16090-1-AP targets GNB2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  Jurkat cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNB2(Guanine nucleotide-binding protein G(I)\/G(S)\/G(T) subunit beta-2) is also named as G protein subunit beta-2, transducin beta chain 2 and belongs to the WD repeat G protein beta family. G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9125 Product name: Recombinant human GNB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC010073 Sequence: MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), beta polypeptide 2\nCalculated Molecular Weight: 340 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC010073\nGene Symbol: GNB2\nGene ID (NCBI): 2783\nRRID: AB_2111939\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62879\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869545287849,"sku":"16090-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16090-1-ap","provider":"Iright","version":"1.0","type":"link"}