{"product_id":"proteintech-16097-1-ap","title":"Proteintech, 16097-1-AP, PELI2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PELI2 (16097-1-AP) by Proteintech is a Polyclonal antibody targeting PELI2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16097-1-AP targets PELI2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPellino2 (PELI2) is a newly discovered E3 ubiquitin ligase, which regulates the protein degradation, protein-protein interaction, protein translocation and signaling transduction via the ubiquitination of target proteins, and plays important roles in inflammation and the immune system. PELI2 possesses a C-terminal RING-like domain and a phospho-threonine-binding forkhead-associated (FHA) domain that are responsible for ubiquitin ligase activity and substrate\nbinding, respectively (PMID: 24699078).IHC\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag8940 Product name: Recombinant human PELI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-420 aa of BC009476 Sequence: RPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID Predict reactive species\nFull Name: pellino homolog 2 (Drosophila)\nCalculated Molecular Weight: 420 aa, 46 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC009476\nGene Symbol: PELI2\nGene ID (NCBI): 57161\nRRID: AB_2878218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HAT8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869726396585,"sku":"16097-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16097-1-ap","provider":"Iright","version":"1.0","type":"link"}