{"product_id":"proteintech-16106-1-ap","title":"Proteintech, 16106-1-AP, GS28 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GS28 (16106-1-AP) by Proteintech is a Polyclonal antibody targeting GS28 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16106-1-AP targets GS28 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells,  HepG2 cells,  human liver tissue,  rat liver tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGS28, also known as GOSR1, is a 28-kDa Golgi SNARE protein that participates in ER-Golgi and intra-Golgi transport. GS28 is considered to be a core component of the Golgi SNARE complex. (PMID: 8638159)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9021 Product name: Recombinant human GS28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC012620 Sequence: MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQV Predict reactive species\nFull Name: golgi SNAP receptor complex member 1\nCalculated Molecular Weight: 28.6 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC012620\nGene Symbol: GS28\nGene ID (NCBI): 9527\nRRID: AB_2294912\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95249\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887660355753,"sku":"16106-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16106-1-ap","provider":"Iright","version":"1.0","type":"link"}