{"product_id":"proteintech-16115-1-ap","title":"Proteintech, 16115-1-AP, PPP1R8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1R8 (16115-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16115-1-AP targets PPP1R8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  HepG2 cells\nPositive IHC detected in: human kidney tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP1R8, also named as ARD1, NIPP1, is a 351 amino acid protein, which has a basic N- and C-terminal and an acidic central domain. PPP1R8 is ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. PPP1R8 has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates and may also be involved in pre-mRNA splicing. PPP1R8 exists many isoforms and molecular weight of modified isoforms is about 18 kDa, 28 kDa and 47 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9041 Product name: Recombinant human PPP1R8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC013360 Sequence: MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI Predict reactive species\nFull Name: protein phosphatase 1, regulatory (inhibitor) subunit 8\nCalculated Molecular Weight: 209 aa, 23 kDa\nObserved Molecular Weight: 47 kDa, 28 kDa, 19 kDa\nGenBank Accession Number: BC013360\nGene Symbol: PPP1R8\nGene ID (NCBI): 5511\nRRID: AB_2169304\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12972\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887770718377,"sku":"16115-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16115-1-ap","provider":"Iright","version":"1.0","type":"link"}