{"product_id":"proteintech-16117-1-ap","title":"Proteintech, 16117-1-AP, RAC1\/2\/3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAC1\/2\/3 (16117-1-AP) by Proteintech is a Polyclonal antibody targeting RAC1\/2\/3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16117-1-AP targets RAC1\/2\/3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, human brain tissue,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRac3 is a GTPase that belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. There are three Rac genes in mammals, which share over 90% protein identity but differ for their pattern of expression. Rac1 is ubiquitous, Rac2 is specific for hematopoietic cells, while Rac3 is prevalent in the developing nervous system. This antibody can recognize Rac1, Rac2, and Rac3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9045 Product name: Recombinant human RAC1\/2\/3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC015197 Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF Predict reactive species\nFull Name: ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)\nCalculated Molecular Weight: 192 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC015197\nGene Symbol: RAC3\nGene ID (NCBI): 5881\nRRID: AB_2176154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868944650409,"sku":"16117-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16117-1-ap","provider":"Iright","version":"1.0","type":"link"}