{"product_id":"proteintech-16121-1-ap","title":"Proteintech, 16121-1-AP, RLIM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RLIM (16121-1-AP) by Proteintech is a Polyclonal antibody targeting RLIM in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n16121-1-AP targets RLIM in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  Jurkat cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRLIM (RING finger LIM domain-binding protein), also known as RNF12 (RING finger protein 12) or NY-REN-43, is a 624 amino acid RING-H2 zinc finger protein that is involved in protein ubiquitinylation and subsequent degradation. Expressed in a variety of tissues, RLIM binds to the LIM domain of various proteins and functions as a protein ligase that negatively co-regulates LIM homeodomain (LIM-HD) transcription factors. Through its interaction with Sin3A, a component of the histone deacetylase corepressor complex, RLIM is able to recruit the corepressor complex to LIM-HD proteins, thereby inhibiting LIM-HD transcription. In addition to recruiting the deacetylase complex to LIM-HD proteins, RLIM is able to bind to, ubiquinate and subsequently degrade CLIM proteins, which function as positive co-regulators of LIM-HD transcription factors. RLIM contains one RING-type zinc finger and is implicated in renal cell carcinoma. The calcualted molecular weight of RLIM is 69 kDa, but modified RLIM is about 70-75 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9077 Product name: Recombinant human RLIM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-350 aa of BC013357 Sequence: SGPELLSRGLFAASGTRNASQGAGSSDTAASGESTGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTP Predict reactive species\nFull Name: ring finger protein, LIM domain interacting\nCalculated Molecular Weight: 624 aa, 69 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC013357\nGene Symbol: RLIM\nGene ID (NCBI): 51132\nRRID: AB_2181967\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVW2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987904169,"sku":"16121-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16121-1-ap","provider":"Iright","version":"1.0","type":"link"}